SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011064012.1.14038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011064012.1.14038
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.53e-81
Family "Hypothetical" protein ybl036c 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011064012.1.14038
Sequence length 232
Comment YggS family pyridoxal phosphate enzyme [Pseudomonas protegens]; AA=GCF_000012265.1; RF=na; TAX=220664; STAX=380021; NAME=Pseudomonas protegens Pf-5; strain=Pf-5; AL=Complete Genome; RT=Major
Sequence
MSTIADNIAQVAERIRNACQAVQRDPHSVQLLAVSKTKPAAALREAHAAGLRDFGENYLQ
EALGKQQELADLPLSWHFIGPIQSNKTRAIAEHFDWVHSVDRLKIAQRLSEQRPAELPPL
NICIQVNVSGEASKSGCAPADLPALASAIGALPRLQLRGLMAIPEPTEDRAAQDAAFAAV
QRLNNDLRDSLKLPLDTLSMGMSHDLEAAIAQGATWVRIGTALFGARDYSQS
Download sequence
Identical sequences A0A2C9EV30 A0A2K2WS97 Q4K4D7
gi|501683198|ref|YP_008003024.1| 220664.PFL_5838 gi|70733123|ref|YP_262896.1| WP_011064012.1.14038 WP_011064012.1.18072 WP_011064012.1.27351 WP_011064012.1.42452 WP_011064012.1.42693 WP_011064012.1.76749 NYSGRC-FDAO-AAY95028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]