SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011078318.1.96968 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011078318.1.96968
Domain Number 1 Region: 91-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000144
Family NfeD domain-like 0.0047
Further Details:      
 
Weak hits

Sequence:  WP_011078318.1.96968
Domain Number - Region: 28-73
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0128
Family LacY-like proton/sugar symporter 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011078318.1.96968
Sequence length 150
Comment hypothetical protein [Vibrio vulnificus]; AA=GCF_000788325.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=99-578 DP-B1; AL=Contig; RT=Major
Sequence
MIELLDGINHWHWLALGLALLAVELLGTAGYFLWLGLSALLVGLLLSLIPMSWQLQWSAF
AVFSLVTTWLWWRKQLAKDQQDDSSRDLNQKQKQLVGQEIILKEDIHAGMNRIQVADTTW
SAHSDIDIPAGSKIKIIALDGIVLKVEVSA
Download sequence
Identical sequences A0A087IGR3
gi|27363685|ref|NP_759213.1| WP_011078318.1.13374 WP_011078318.1.17874 WP_011078318.1.28215 WP_011078318.1.28571 WP_011078318.1.31968 WP_011078318.1.43691 WP_011078318.1.53782 WP_011078318.1.553 WP_011078318.1.58875 WP_011078318.1.59451 WP_011078318.1.60167 WP_011078318.1.67868 WP_011078318.1.81060 WP_011078318.1.81555 WP_011078318.1.84562 WP_011078318.1.86748 WP_011078318.1.93668 WP_011078318.1.96968 216895.VV1_0203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]