SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011079096.1.93668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011079096.1.93668
Domain Number 1 Region: 27-209
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.05e-58
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000818
Further Details:      
 
Domain Number 2 Region: 348-487
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.87e-42
Family Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) 0.002
Further Details:      
 
Domain Number 3 Region: 210-341
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 4.08e-40
Family Acetohydroxy acid isomeroreductase (ketol-acid reductoisomerase, KARI) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011079096.1.93668
Sequence length 494
Comment MULTISPECIES: ketol-acid reductoisomerase [Vibrio]; AA=GCF_002117205.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=FORC_036; AL=Complete Genome; RT=Major
Sequence
MANYFNTLNLREQLDQLGRCRFMDRSEFATEADYLKGKKVVIVGCGAQGLNQGLNMRDSG
LDVAYALRQAAIDEQRQSYKNAKENGFEVGSYETLIPQADLVVNLTPDKQHTNVVETVMP
LMKEGAALGYSHGFNVVEEGMQIRKDLTVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPKGEGWDIAKAWAAATGGHRAGCLESSFVAEVKSDLMGEQTILCGMLQAGSIVCYEKM
VAEGIDPGYAGKLLQYGWETITEALKFGGITHMMDRLSNPAKIKAFELSEELKDLMRPLY
NKHMDDIISGHFSSTMMADWANDDANLLGWRAETGETAFENYPSTDVEISEQEYFDNGIL
MVAMVRAGVELAFEAMTASGIIDESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFANVATPLLREKFMPSVGTDVIGKGLGETSNQVDNATLIAVNETIRNHPVEYIGEEL
RGYMTDMKRIAVGG
Download sequence
Identical sequences A0A1L9KS06 A0A1V8MNI8 Q7MQH3 Q8DDC8
gi|37678219|ref|NP_932828.1| 196600.VV0035 216895.VV1_1077 WP_011079096.1.13374 WP_011079096.1.16238 WP_011079096.1.17874 WP_011079096.1.25536 WP_011079096.1.31968 WP_011079096.1.33883 WP_011079096.1.34622 WP_011079096.1.39407 WP_011079096.1.53345 WP_011079096.1.53782 WP_011079096.1.553 WP_011079096.1.58885 WP_011079096.1.60868 WP_011079096.1.61535 WP_011079096.1.65015 WP_011079096.1.66219 WP_011079096.1.67868 WP_011079096.1.73066 WP_011079096.1.78668 WP_011079096.1.81460 WP_011079096.1.8379 WP_011079096.1.86748 WP_011079096.1.93668 WP_011079096.1.94371 WP_011079096.1.9921 gi|320154900|ref|YP_004187279.1| gi|27364500|ref|NP_760028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]