SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011079140.1.81460 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011079140.1.81460
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.66e-39
Family Frataxin-like 0.0000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011079140.1.81460
Sequence length 104
Comment MULTISPECIES: iron donor protein CyaY [Vibrio]; AA=GCF_000959775.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=CG64; AL=Contig; RT=Major
Sequence
MNNTEFHQLVDNELQLIEEAIDESGADIDYETTGNVMTLEFDDRSQIIINRQEPMQEIWL
ASKSGGFHFQYKAGQWICSKTGVEFAHMVKQECEKHAGESIDWA
Download sequence
Identical sequences A0A087IEF3 A0A0H0Y043 A0A1L9KRV7 Q7MQC4 Q8DD83
gi|320154946|ref|YP_004187325.1| gi|37678268|ref|NP_932877.1| gi|27364545|ref|NP_760073.1| 196600.VV0085 216895.VV1_1124 WP_011079140.1.100126 WP_011079140.1.13374 WP_011079140.1.16238 WP_011079140.1.17874 WP_011079140.1.21633 WP_011079140.1.22486 WP_011079140.1.22778 WP_011079140.1.24453 WP_011079140.1.25536 WP_011079140.1.28215 WP_011079140.1.28571 WP_011079140.1.30871 WP_011079140.1.31968 WP_011079140.1.34622 WP_011079140.1.39407 WP_011079140.1.39524 WP_011079140.1.43691 WP_011079140.1.47396 WP_011079140.1.49981 WP_011079140.1.512 WP_011079140.1.53345 WP_011079140.1.53782 WP_011079140.1.54486 WP_011079140.1.54603 WP_011079140.1.54858 WP_011079140.1.55006 WP_011079140.1.553 WP_011079140.1.58875 WP_011079140.1.58885 WP_011079140.1.59022 WP_011079140.1.59048 WP_011079140.1.59451 WP_011079140.1.60167 WP_011079140.1.60868 WP_011079140.1.61535 WP_011079140.1.63462 WP_011079140.1.63825 WP_011079140.1.65015 WP_011079140.1.66219 WP_011079140.1.66581 WP_011079140.1.67868 WP_011079140.1.73066 WP_011079140.1.73173 WP_011079140.1.78369 WP_011079140.1.78668 WP_011079140.1.79678 WP_011079140.1.81060 WP_011079140.1.81460 WP_011079140.1.81555 WP_011079140.1.82587 WP_011079140.1.8292 WP_011079140.1.8379 WP_011079140.1.84562 WP_011079140.1.86005 WP_011079140.1.86748 WP_011079140.1.89979 WP_011079140.1.90288 WP_011079140.1.93668 WP_011079140.1.94371 WP_011079140.1.95941 WP_011079140.1.96968 WP_011079140.1.9921 WP_011079140.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]