SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011079498.1.73173 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011079498.1.73173
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.84e-56
Family G proteins 0.00017
Further Details:      
 
Domain Number 2 Region: 165-288
Classification Level Classification E-value
Superfamily Translation proteins 3.31e-29
Family Elongation factors 0.0051
Further Details:      
 
Domain Number 3 Region: 399-493
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.97e-24
Family EF-G/eEF-2 domains III and V 0.007
Further Details:      
 
Domain Number 4 Region: 292-370
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.09e-18
Family EF-G/eEF-2 domains III and V 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011079498.1.73173
Sequence length 597
Comment MULTISPECIES: elongation factor 4 [Vibrio]; AA=GCF_002073065.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=VN-0288; AL=Contig; RT=Major
Sequence
MKHIRNFSIIAHIDHGKSTLSDRLIQVCGGLSDREMAEQVLDSMELERERGITIKAQSVT
LDYKAQDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAI
EMDLEVVPILNKIDLPAAEPERVAEEIEDIVGIDAIDAVRCSAKTGLGVDDVLEKIVSAI
PAPEGDPEAPLQALIIDSWFDNYLGVVSLVRIKHGKLKKNDKIKVMSTGQVWGVDRLGIF
TPKQIDTTELNTGEVGWVVCGIKDILGAPVGDTLTLAKNGAEKALPGFKKVKPQVYAGLF
PVSSDDYEAFRDALGKLSLNDASLFYEPENSAALGFGFRCGFLGMLHMEIIQERLEREYD
LDLITTAPTVVYEVLTTSKQTIYVDSPAKLPAVNDVAEIREPIARCNILVPADYLGNVIT
LCIEKRGTQVDMVYHGNQVALTYDIPMAEVVLDFFDRLKSTSRGYASLDYGFQRFEESNM
VRVDVLLNGDKVDALAIITHKDQSQTRGRQLVEKMKEFIPRQMFDIAIQAAIGNHIIARS
TVKQLRKNVLAKCYGGDVSRKKKLLKKQKEGKKRMKQIGNVELPQEAFLAILHVGKD
Download sequence
Identical sequences A0A1L9L4F3 A0A1V8MUK5 Q7MHN6 Q8DC78
WP_011079498.1.100126 WP_011079498.1.16238 WP_011079498.1.17874 WP_011079498.1.21633 WP_011079498.1.22486 WP_011079498.1.22778 WP_011079498.1.24453 WP_011079498.1.31968 WP_011079498.1.33883 WP_011079498.1.34622 WP_011079498.1.39407 WP_011079498.1.39524 WP_011079498.1.43691 WP_011079498.1.49981 WP_011079498.1.53345 WP_011079498.1.54486 WP_011079498.1.54858 WP_011079498.1.55006 WP_011079498.1.59022 WP_011079498.1.59048 WP_011079498.1.73173 WP_011079498.1.78369 WP_011079498.1.81460 WP_011079498.1.81555 WP_011079498.1.82587 WP_011079498.1.8292 WP_011079498.1.86005 WP_011079498.1.89979 WP_011079498.1.93668 WP_011079498.1.94371 WP_011079498.1.95941 WP_011079498.1.99976 196600.VV2833 216895.VV1_1563 gi|27364932|ref|NP_760460.1| gi|37681017|ref|NP_935626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]