SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011079821.1.90288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011079821.1.90288
Domain Number - Region: 72-147
Classification Level Classification E-value
Superfamily BRCT domain 0.000589
Family DNA topoisomerase II binding protein 1, TopBP1 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011079821.1.90288
Sequence length 158
Comment MULTISPECIES: membrane protein [Vibrio]; AA=GCF_001558515.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=ATL 6-1306; AL=Complete Genome; RT=Major
Sequence
MRYSIDHYDNQGYLKAPLLLWFGWFFLARAWVVFAGAGASRESGGKILQIVYPDNHTLYL
GLLIGIPSVLLMWIMGLRKPGRQWIDKLTNYGRGFTLCLVLGQIVQTTYHVYLEHGEFSW
TNGLTLLILLWFGIYVFNSQWVKDCFHVPNLPTDDNLN
Download sequence
Identical sequences A0A0H0Y4H4 A0A1V8MVR7 Q7MIM1
196600.VV2495 gi|37680679|ref|NP_935288.1| gi|320155651|ref|YP_004188030.1| gi|326423909|ref|NP_760795.2| WP_011079821.1.13374 WP_011079821.1.16238 WP_011079821.1.17874 WP_011079821.1.22486 WP_011079821.1.25536 WP_011079821.1.33883 WP_011079821.1.34622 WP_011079821.1.39524 WP_011079821.1.53782 WP_011079821.1.54486 WP_011079821.1.553 WP_011079821.1.58885 WP_011079821.1.66581 WP_011079821.1.73066 WP_011079821.1.73173 WP_011079821.1.79678 WP_011079821.1.81460 WP_011079821.1.82587 WP_011079821.1.8379 WP_011079821.1.86748 WP_011079821.1.90288 WP_011079821.1.93668 WP_011079821.1.94371 WP_011079821.1.9921 WP_011079821.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]