SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011080000.1.90288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011080000.1.90288
Domain Number 1 Region: 55-233
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.76e-44
Family Pseudouridine synthase RsuA/RluD 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011080000.1.90288
Sequence length 234
Comment 23S rRNA pseudouridine synthase E [Vibrio vulnificus]; AA=GCF_001558515.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=ATL 6-1306; AL=Complete Genome; RT=Major
Sequence
MSFRSSSTSPRSNKQTATKRFKQSGQAQSVGSPKRHSVKRKNNEQSKKSLSLAERKIIIF
NKPYDTLSQFTDGEGRKTLADFIPVKEVYAAGRLDRDSEGLMVLTNDGILQAKLTQPKSK
SPKTYWVQVEGAPTEAQLEPLRRGVELKDGLTLPAQVEIIQDPQLWERNPPVRFRAAIPT
TWLAITIIEGRNRQVRRMTAHIGFPTLRLVRYSMGGMTLQDLQPGEWKEISLPS
Download sequence
Identical sequences Q7MJ37 Q8DAS3
196600.VV2326 216895.VV1_2116 WP_011080000.1.16238 WP_011080000.1.17874 WP_011080000.1.34622 WP_011080000.1.39407 WP_011080000.1.54486 WP_011080000.1.55006 WP_011080000.1.90288 WP_011080000.1.9921 WP_011080000.1.99976 gi|27365449|ref|NP_760977.1| gi|37680510|ref|NP_935119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]