SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011080669.1.33883 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011080669.1.33883
Domain Number 1 Region: 60-228
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4e-43
Family Pseudouridine synthase RsuA/RluD 0.00000177
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000000115
Family Pseudouridine synthase RsuA N-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011080669.1.33883
Sequence length 233
Comment MULTISPECIES: 16S rRNA pseudouridine(516) synthase [Vibrio]; AA=GCF_000959845.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=SC9794; AL=Contig; RT=Major
Sequence
MRLDKFLCDALGATRKEATKILKSGEVTVNEQVQKSGAVKVTEECVVEWQGRELAMQGPR
YIMLYKPEGFVCSHEDGFNHTAFVLLDEVKMDELHFAGRLDVDTTGLVLITDDGKWSHRI
TSPKHKCDKTYRVWLADPIGSDYAEKLAEGVQLRNEKELTLPAQMTIVNADENEVLLTIH
EGKYHQVKRMFAALGNKVEQLHRERIGAIELDESLEPGEYRYLTQEEIDSVWK
Download sequence
Identical sequences A0A1L9L860 A0A1V8MYP9 Q7MLK1 Q8D8X2
WP_011080669.1.17874 WP_011080669.1.33883 WP_011080669.1.34622 WP_011080669.1.39524 WP_011080669.1.53345 WP_011080669.1.54486 WP_011080669.1.58885 WP_011080669.1.73173 WP_011080669.1.82587 WP_011080669.1.94371 WP_011080669.1.99976 gi|37679610|ref|NP_934219.1| 196600.VV1426 216895.VV1_2843 gi|27366125|ref|NP_761653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]