SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011080865.1.78668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011080865.1.78668
Domain Number 1 Region: 1-203
Classification Level Classification E-value
Superfamily YrdC/RibB 5.49e-64
Family YrdC-like 0.0000000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011080865.1.78668
Sequence length 206
Comment MULTISPECIES: threonylcarbamoyl-AMP synthase [Vibrio]; AA=GCF_002150885.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=VN-0208; AL=Contig; RT=Major
Sequence
MSQFFYVHPENPQARLINQAVAIIRNGGVVVYPTDSGYALGCQLENKQALDRICQIRRLD
EKHNFTLLCRDLSELSIYARVDNTAFRLLKNNTPGPYTFIFKGTKEVPRRLMNAKRKTIG
IRVPDNRIALDLLDALGEPLMSTSLILPGKEVTEADPEEIRDKLEHAVDVILNGGYLGEQ
PTTVIDFSEGDAVVARIGSGDPAPFE
Download sequence
Identical sequences A0A0H0Y8H7 A0A1L9L7I5 A0A1V8MYW1 Q7MM49
gi|320156839|ref|YP_004189218.1| 196600.VV1224 216895.VV1_3062 gi|37679408|ref|NP_934017.1| gi|27366331|ref|NP_761859.1| WP_011080865.1.16238 WP_011080865.1.17874 WP_011080865.1.22486 WP_011080865.1.22778 WP_011080865.1.25536 WP_011080865.1.28571 WP_011080865.1.30871 WP_011080865.1.33883 WP_011080865.1.34622 WP_011080865.1.39407 WP_011080865.1.39524 WP_011080865.1.47396 WP_011080865.1.49981 WP_011080865.1.53345 WP_011080865.1.53782 WP_011080865.1.54486 WP_011080865.1.55006 WP_011080865.1.553 WP_011080865.1.58875 WP_011080865.1.58885 WP_011080865.1.59451 WP_011080865.1.60167 WP_011080865.1.61535 WP_011080865.1.66581 WP_011080865.1.73066 WP_011080865.1.73173 WP_011080865.1.78668 WP_011080865.1.79678 WP_011080865.1.81060 WP_011080865.1.81460 WP_011080865.1.82587 WP_011080865.1.8379 WP_011080865.1.86005 WP_011080865.1.86748 WP_011080865.1.90288 WP_011080865.1.93668 WP_011080865.1.94371 WP_011080865.1.96968 WP_011080865.1.9921 WP_011080865.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]