SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011090476.1.90507 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011090476.1.90507
Domain Number 1 Region: 176-291
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000147
Family L-arabinose binding protein-like 0.011
Further Details:      
 
Weak hits

Sequence:  WP_011090476.1.90507
Domain Number - Region: 38-197,240-266
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000942
Family L-arabinose binding protein-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011090476.1.90507
Sequence length 334
Comment MULTISPECIES: ABC transporter substrate-binding protein [Bradyrhizobium]; AA=GCF_000261765.1; RF=na; TAX=502063; STAX=502063; NAME=Bradyrhizobium sp. CCBAU 41267; strain=CCBAU 41267; AL=Contig; RT=Major
Sequence
MSLDLMVRPLNRRACLALLGTIVVLPASAQAQQANATRRLGVLSVTAADDAIGQTRSAIL
VEALAAHGWKEHGNLRIDWRSGAGDRARIAGLADELIALKPDILLAVGTPSVEELRRRTA
MIPIVFAVVTDPVSQGFVQNLAHPGGNITGFTDYDGPLAGKWLEMLTQVTPKVSRVFVVY
NPATAPFAALMLRTIEDAARTLHVTVEPAPVHDAASIAALASRKDGGLLILPDFFTMANR
AHLLAAVREARVPAVFWSRTFVDEGGLMSYSTDSAEQLRRAAGYIDRILKGAQAADLPVQ
NPTKFELAVNLKAAKALGVTIPPGLLATANDVIE
Download sequence
Identical sequences A0A2A6MWA2 Q89CP5
gi|27382862|ref|NP_774391.1| 224911.bll7751 NP_774391.1.11505 WP_011090476.1.15658 WP_011090476.1.90507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]