SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011092786.1.57850 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011092786.1.57850
Domain Number 1 Region: 91-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000157
Family NfeD domain-like 0.0057
Further Details:      
 
Weak hits

Sequence:  WP_011092786.1.57850
Domain Number - Region: 28-82
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000798
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011092786.1.57850
Sequence length 151
Comment membrane protein [Pectobacterium atrosepticum]; AA=GCF_000749905.1; RF=na; TAX=29471; STAX=29471; NAME=Pectobacterium atrosepticum; strain=NCPPB 549; AL=Contig; RT=Major
Sequence
MGIELVMENAHWFWLSLGGLLLAAEMLGGSGYLLWSGLSAVLVGLLTWIMPLGWPWQGTI
FAILTIVTALLWWYWLRKRTLSRPPSTLNQRGQQLVGLRATVSESVTNGFGRVNIGDSSW
RVKSEQDLPAGTHVEVIAVDGITLHVRSIER
Download sequence
Identical sequences Q6D7Y0
GO.2760 WP_011092786.1.17763 WP_011092786.1.32123 WP_011092786.1.57850 WP_011092786.1.77917 WP_011092786.1.79946 WP_011092786.1.80346 WP_011092786.1.94180 gi|50120134|ref|YP_049301.1| 218491.ECA1195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]