SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011096058.1.30872 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011096058.1.30872
Domain Number 1 Region: 5-194
Classification Level Classification E-value
Superfamily Formyltransferase 2.49e-53
Family Formyltransferase 0.0000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011096058.1.30872
Sequence length 212
Comment phosphoribosylglycinamide formyltransferase [Tropheryma whipplei]; AA=GCF_000359225.2; RF=na; TAX=1294029; STAX=2039; NAME=Tropheryma whipplei str. Dig10; strain=Dig10; AL=Scaffold; RT=Major
Sequence
MKTAMRLIVMVSGIGSGLLRLIRACEQKELKAEIVAVGSDRHAPALSHASDYGIPFFVSP
FKEYSNRDAWGANLLNTVLAYKPDLVVLSGFMRILPSCVVDALSPNLINTHPSYLPEFPG
MNAVEDALRAGVKTTGASVIRVDNGIDTGPVISQMRVKVYSSDTCQTLHSRIKKVEHLLL
CRAIKNIYTEQFILKNLLHNSVRRPSGKTGDR
Download sequence
Identical sequences gi|28572260|ref|NP_789040.1| 218496.TW093 WP_011096058.1.1961 WP_011096058.1.2273 WP_011096058.1.30872 WP_011096058.1.3524 WP_011096058.1.35576 WP_011096058.1.36967 WP_011096058.1.41189 WP_011096058.1.42537 WP_011096058.1.52318 WP_011096058.1.64596 WP_011096058.1.7325 WP_011096058.1.77801 WP_011096058.1.80906 WP_011096058.1.86550 WP_011096058.1.87151 WP_011096058.1.88484 WP_011096058.1.91097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]