SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011098951.1.71400 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011098951.1.71400
Domain Number 1 Region: 89-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000418
Family NfeD domain-like 0.0069
Further Details:      
 
Weak hits

Sequence:  WP_011098951.1.71400
Domain Number - Region: 10-72
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00209
Family Glycerol-3-phosphate transporter 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011098951.1.71400
Sequence length 146
Comment hypothetical protein [Clostridium tetani]; AA=GCF_000762325.1; RF=na; TAX=1513; STAX=1513; NAME=Clostridium tetani; strain=ATCC 453; AL=Scaffold; RT=Major
Sequence
MYSQILLWIVIGATAITVDIFTSSFLFVWFTIGSIVALIISSLGYSFSVQFIAFIFTSVV
LLAVGYPIVRKTIKKSVPKTLPMGQNYINRIITVEKDIKEEELIKIDGIYWTVLNEGKLI
KKGEKAKIIALNGNKFILKKYEEDAK
Download sequence
Identical sequences A0A1T4QQ28 Q897Q1
gi|28210404|ref|NP_781348.1| 212717.CTC00680 WP_011098951.1.12609 WP_011098951.1.27827 WP_011098951.1.49058 WP_011098951.1.52649 WP_011098951.1.71400 WP_011098951.1.81004 WP_011098951.1.83101 WP_011098951.1.84243 WP_011098951.1.96257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]