SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011100572.1.52649 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011100572.1.52649
Domain Number 1 Region: 7-149
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.31e-34
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011100572.1.52649
Sequence length 152
Comment ribosomal-protein-alanine N-acetyltransferase RimI [Clostridium tetani]; AA=GCF_000762315.1; RF=na; TAX=1172203; STAX=1513; NAME=Clostridium tetani ATCC 9441; strain=ATCC 9441; AL=Scaffold; RT=Major
Sequence
MNNLNDILLCKATKEHIEEIFNINKLSFLAPWSIQSIEKEILSNPHALYIVAIKDNKILG
YGGLWIILDEGHVTNIAIHPNYRQLGIASLVLSTLIKESKNRGVNSITLEVRKSNSVAQN
LYQKFGFVEEGCRKHYYSDNLEDAIIMWKHDI
Download sequence
Identical sequences A0A1T4N1A0 Q891D4
212717.CTC02445 gi|28212030|ref|NP_782974.1| WP_011100572.1.12609 WP_011100572.1.27827 WP_011100572.1.49058 WP_011100572.1.52649 WP_011100572.1.71400 WP_011100572.1.81004 WP_011100572.1.83101 WP_011100572.1.84243 WP_011100572.1.96257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]