SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011103017.1.17870 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011103017.1.17870
Domain Number 1 Region: 425-510
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011103017.1.17870
Sequence length 522
Comment sodium-independent anion transporter [Pseudomonas syringae group genomosp. 3]; AA=GCF_000980905.1; RF=na; TAX=237306; STAX=251701; NAME=Pseudomonas syringae pv. persicae; strain=NCPPB 2254; AL=Contig; RT=Major
Sequence
MRWLNRHKFLPFLAWLPQQSRASVGRDALVGLSGAILALPQSIAYALIAGLPPEYGLYAA
IVPVLIACLWGSSWHLICGPTAAISIVLYVSVSPLAVPASQDYIMLILLLTFIAGVFQLL
LGMMRFGALVNFVSHSVVLGFTLGAAVVIALGQMPNLLGIDLPSQTTALKSLSAVLEHRG
ELDKPSLMLGLLTLTLGIGLKAWVPRWPTLLIALVSSSLLVWLWPAMFGHVRVVSAFVGH
LPPFSPLPLDLELILKLLPTAVAVGMLGLVNSLSIARSLSARSQQMLNANQEVRAQGLSN
MVGSLFSGYLSAGSFTRAALSYEAGARSPLAGVFSALWVALFAVAGASLVSHIPIPAMAA
SILLICWGLVDRRGIRALLRVSRAEFFVMALTCLATLLLELQTAIYAGVLASLFFYLKRT
SQPRVQQWREGDEDVLRVGGSIFFGASHYLQTRLQRTEGLRVVIDAQQINFIDYSGVEML
HQEARRLGQQGRVLVLRNARPLVIEELHKLEGPENCPILFED
Download sequence
Identical sequences A0A0N0WRZ7 A0A0Q0D653 Q88B51
223283.PSPTO_0168 NP_790027.1.37326 WP_011103017.1.14276 WP_011103017.1.17870 WP_011103017.1.6959 WP_011103017.1.87092 GO.9010 gi|28867408|ref|NP_790027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]