SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011110110.1.97262 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011110110.1.97262
Domain Number - Region: 8-60
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz alpha-1 subunit 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011110110.1.97262
Sequence length 62
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_002021515.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=MOD1_Bc86; AL=Scaffold; RT=Major
Sequence
MYSRKDKEMQLKEYMNQTFPGVTLGPYLYSQWENHLHFDFGKDKYQIVEGTDDLNMEYFS
QL
Download sequence
Identical sequences A0A1S9YJ29 Q81D78
gi|30020628|ref|NP_832259.1| NP_832259.1.86172 WP_011110110.1.14174 WP_011110110.1.18914 WP_011110110.1.20651 WP_011110110.1.22699 WP_011110110.1.23540 WP_011110110.1.25290 WP_011110110.1.26637 WP_011110110.1.28237 WP_011110110.1.32784 WP_011110110.1.33201 WP_011110110.1.33717 WP_011110110.1.36221 WP_011110110.1.38345 WP_011110110.1.40034 WP_011110110.1.46326 WP_011110110.1.54240 WP_011110110.1.57732 WP_011110110.1.58822 WP_011110110.1.59997 WP_011110110.1.64282 WP_011110110.1.76155 WP_011110110.1.76902 WP_011110110.1.88154 WP_011110110.1.88269 WP_011110110.1.90254 WP_011110110.1.93683 WP_011110110.1.97262 WP_011110110.1.98604 226900.BC2500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]