SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011112397.1.14462 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011112397.1.14462
Domain Number 1 Region: 162-347
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.15e-73
Family Methylesterase CheB, C-terminal domain 0.000000262
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 1.42e-27
Family CheY-related 0.00000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011112397.1.14462
Sequence length 358
Comment chemotaxis response regulator protein-glutamate methylesterase [Nitrosomonas europaea]; AA=GCF_000009145.1; RF=representative genome; TAX=228410; STAX=915; NAME=Nitrosomonas europaea ATCC 19718; strain=ATCC 19718; AL=Complete Genome; RT=Major
Sequence
MKKISVLIIDDSALIRKLLTEIINARPDMEVIGAAPDPIVAREMIRTLNPDVLTLDVEMP
KMDGLEFLEKLMRLRPMPVVMVSTLTERGSEVTFRALELGAVDFVAKPKMDIRNSLEAYT
DEITGKIRTASTARIHRLEPVASNGAASGSIVQMPRHHGISTEKLIIIGASTGGTEAIKD
VLIHLPPDCPGILITQHMPEGFTRSFAERLDRLCKIRVKEAEGGERVLPGHAYLAPGHSH
LLLKKSGANYVTELSQTDPVNRHRPSVDVLFQSAAHCAGKNAVGVILTGMGKDGAAGMLD
MHHAGAYNLAQDETSCVVFGMPKEAITLGAVDEIVPLQDMARRILARLVGAGKQAVRV
Download sequence
Identical sequences A0A1I0CXK0 Q820K0
WP_011112397.1.11244 WP_011112397.1.14462 WP_011112397.1.55826 WP_011112397.1.61914 gi|30249811|ref|NP_841881.1| 228410.NE1859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]