SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011139024.1.32730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011139024.1.32730
Domain Number 1 Region: 19-262
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.29e-69
Family FdhD/NarQ 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011139024.1.32730
Sequence length 286
Comment sulfurtransferase FdhD [Wolinella succinogenes]; AA=GCF_000196135.1; RF=representative genome; TAX=273121; STAX=844; NAME=Wolinella succinogenes DSM 1740; strain=DSMZ 1740; AL=Complete Genome; RT=Major
Sequence
MRHTDRFVKKVVIERIGDQRVLAEEEDVVIKEERISLYLNGTKLMSMMSLPSDQDAHAVG
FLMSEGVIEKIEDLKSVQISSDGSSVYVEALINHENITNLFKEKTLTSGCCVGVTGNLEG
NVLRKFIATPMQISLERIWEGMEEFEMSSHLFHETGCVHKASLLLEDGSKITAEDIGRHN
AIDKVMGKARLGRIDTEKAVLVVSGRLSMEMVVKAVMHNIPMIVSRAAATFLGIKTAQEL
GVTLVGFARGEKMNIYTHSGRVDLRACKRKRGVTLHAPNQSSSLLR
Download sequence
Identical sequences P28181
gi|34557521|ref|NP_907336.1| WP_011139024.1.32730 273121.WS1149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]