SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011149315.1.34622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011149315.1.34622
Domain Number 1 Region: 5-203
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.7e-44
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 211-304
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 6.8e-27
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.0072
Further Details:      
 
Domain Number 3 Region: 322-413
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 1.31e-17
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011149315.1.34622
Sequence length 420
Comment UDP-N-acetyl-D-mannosamine dehydrogenase [Vibrio vulnificus]; AA=GCF_000009745.1; RF=na; TAX=196600; STAX=672; NAME=Vibrio vulnificus YJ016; strain=YJ016; AL=Complete Genome; RT=Major
Sequence
MSFETISVIGLGYIGLPTAAMFASRKKKVIGVDVNQHAVDTINQGKIHIVEPDLDMMVHA
AVSGGYLKATTTPEAADAFLIAVPTPFLPCAEGDIPPPDLSYIEAASKAIAPVLKKGDLV
ILESTSPVGATEKMAAWLAEARSDLTFPQTYGEEADVNIAHCPERVLPGHVVRELVENDR
VIGGLTPKCSARAVELYKTFVQGECVITNARTAEMAKLTENSSRDVQIAFANELSIICDK
LDINVWELIALANRHPRVNILQPGPGVGGHCIAVDPWFIVSKTPEEAQIIHMARKVNDSK
PQWVINKVKLAIADFLQANPEKTAKDMTIACYGLAFKSDIDDLRESPSLEIAKKVSEFHR
GKVLVVEPNIAQLPSELDGNVDLVDISDTNYADLHVVLVGHKEFGSNLFDKKNTIFAVNV
Download sequence
Identical sequences Q7MPM1
WP_011149315.1.34622 196600.VV0342 gi|37678526|ref|NP_933135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]