SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011149565.1.33883 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011149565.1.33883
Domain Number 1 Region: 242-366
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.04e-39
Family TyrA dimerization domain-like 0.0000116
Further Details:      
 
Domain Number 2 Region: 91-237
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.3e-38
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000107
Further Details:      
 
Domain Number 3 Region: 4-88
Classification Level Classification E-value
Superfamily Chorismate mutase II 1.03e-23
Family Dimeric chorismate mutase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011149565.1.33883
Sequence length 375
Comment bifunctional chorismate mutase/prephenate dehydrogenase [Vibrio vulnificus]; AA=GCF_000959845.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=SC9794; AL=Contig; RT=Major
Sequence
MAVELNALREQIDAVDKQMLALLAQRLALVEQVGHVKSQHGLPIYAPDREAAMLASRRAE
AEKIGVPPQLIEDILRRTMRESYASEKDSGFKCLNPDLRSVVIIGGHGQLGGLFARMFTL
SGYQVKILGSKDWHRADEILDGAGLVVVTVPIHLTQGVIEKLTQLPSDCILCDLTSIKSK
PLKTMLDVHSGPVVGLHPMFGPDVPSLAKQVIVYCDGRGAEQYQWLLQQFKIWGASLCQI
EASEHDHGMTLIQALRHFTSFAYGMHLSQENPSLDKLLKLSSPIYRLELAMVGRLFAQDP
NLYGDIILSSQENIDMIKRFHRRFGEALEMLDQHDKARFVERFTQVSDWFGGYSQQFMAE
SQNLLKQANDNLHRD
Download sequence
Identical sequences A0A0H0XZ92 A0A2J9V9V0 Q7MNL3
196600.VV0702 WP_011149565.1.21633 WP_011149565.1.22778 WP_011149565.1.33883 WP_011149565.1.34622 WP_011149565.1.55006 WP_011149565.1.58885 WP_011149565.1.63462 WP_011149565.1.66581 WP_011149565.1.79678 WP_011149565.1.90288 WP_011149565.1.9921 gi|37678886|ref|NP_933495.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]