SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011149733.1.93668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011149733.1.93668
Domain Number 1 Region: 66-227
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.04e-38
Family Pseudouridine synthase RsuA/RluD 0.0003
Further Details:      
 
Domain Number 2 Region: 8-61
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000000000118
Family Ribosomal protein S4 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011149733.1.93668
Sequence length 347
Comment 23S rRNA pseudouridine synthase F [Vibrio vulnificus]; AA=GCF_002117205.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=FORC_036; AL=Complete Genome; RT=Major
Sequence
MSQDNAKRLNKYISETGFCSRREADKLIEQGRVTINGKQPEMGTKVLPGDDVCVDGKPVA
AKEKPVYIALNKPTGITCTTERNIPGNIVDFIGHKKRIFPIGRLDKPSDGLIFLTNDGDI
VNKILRAGNHHEKEYVVRVDKPITPEFIKAMSSGVNILDTVTLPCKVTQETKFSFRIVLT
QGLNRQIRRMCEALGYEVFKLRRVRIMNISLDGIPNGKWRYLTDDEVTEILAMCEGSVGT
EEASRVDAKGRRIRKATDAKLFDSREENQTSTARRNQKQRTFKGNNADEFRHAPNSKKAQ
QRKQQDGDKPRFEKPKRQEQAGKAKRYDNPNAAKPVKRTGGTLTLKK
Download sequence
Identical sequences A0A1W6M1Y8 Q7MMX9
gi|37679122|ref|NP_933731.1| 196600.VV0938 WP_011149733.1.33883 WP_011149733.1.34622 WP_011149733.1.39407 WP_011149733.1.58885 WP_011149733.1.93668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]