SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011149741.1.8379 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011149741.1.8379
Domain Number 1 Region: 3-301
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.22e-108
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 302-464
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 4.58e-47
Family C-terminal domain of glutamyl-tRNA synthetase (GluRS) 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011149741.1.8379
Sequence length 474
Comment glutamate--tRNA ligase [Vibrio vulnificus]; AA=GCF_001889185.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=S2-22; AL=Scaffold; RT=Major
Sequence
MTVKTRFAPSPTGYLHVGGARTALYSWLYAKSQGGEFVLRIEDTDLERNSQEAVDAILEG
MQWLGLEWNEGPYFQTQRFDRYNEMVDKLLAEDKAYKCYASKELLDEVRAEQEANKEMPR
YDAEHPKIKAANEAAKDGDPCVIRFRNPKEGSVVFEDQIRGRIEISNSQMDDLIIRRTDG
SPTYNFCVVVDDWDMGITHVIRGEDHINNTPRQINIYEALGAPVPTFAHCAMILGDDGAK
LSKRHGAVSVMQYRDMGYLPVALNNYLVRLGWSHGDQEIFSQEEMINLFSLNAISKSASA
FNTDKLLWLNNHYIKTSDPKYVAEHLQWHLDQKDIKTENGPAITDVIKLVGERCNTLVEL
ADQIGYFYQDFDAFDADAAKKHLRGVAKQPLEVALAKVEALTEWTTENLHQVIADVCTDL
EIGMGKIGMPLRVAVTGGGQSPSVDAVMQLIGKERVVARIKMALAFIAEREANA
Download sequence
Identical sequences Q7MMW8
WP_011149741.1.33883 WP_011149741.1.34622 WP_011149741.1.8379 WP_011149741.1.9921 196600.VV0949 gi|37679133|ref|NP_933742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]