SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011149956.1.73066 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011149956.1.73066
Domain Number 1 Region: 10-146,181-392
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.34e-98
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000000302
Further Details:      
 
Domain Number 2 Region: 391-603
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 6.35e-44
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.000000756
Further Details:      
 
Domain Number 3 Region: 588-689
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.13e-34
Family Myf domain 0.00017
Further Details:      
 
Domain Number 4 Region: 147-181
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.000000000000602
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011149956.1.73066
Sequence length 690
Comment methionine--tRNA ligase [Vibrio vulnificus]; AA=GCF_000186585.1; RF=na; TAX=914127; STAX=672; NAME=Vibrio vulnificus MO6-24/O; strain=MO6-24/O; AL=Complete Genome; RT=Major
Sequence
MANDPRNFPQRKLLVTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNIVNFICADDAH
GTPIMLKAQQMGMSPEEMIAAVSIEHQKDFAGFDISFDNYHSTHSDENRELASHIYLQLK
KNGFISSRTISQLFDPEKEMFLPDRFVKGTCPKCKSEDQYGDNCDACGETYSPTELINPK
SAVSGATPVMKDSEHFFFDLPQFESMLKEWTRSGSLQTETANKMQEWFESGLQQWDISRD
APYFGFEIPGEKDKFFYVWLDAPIGYMGSFKNLCDKRDDLDFDEYWNKDSKTELYHFIGK
DIVYFHSLFWPAMLDGSGFRKPNNVFVHGYVTVNGAKMSKSKGTFVKASTYLEHLDPECL
RYYYAAKLNSRIDDLDLNLEDFTQRVNADVVNKIVNLASRNAGFIAKRFEGKLAENFVEP
ELYNEFVAAADRIAELYEAREFGRAIREITALADKANQYVDEKAPWVVAKQEGKDQELQE
ICSVGINLFRVLMTYLKPVMPALAARTEAFLNEELTWEGVAQPLTAHEITAFKALFNRID
PKNIEAMIEASKEDAAAEMAAKEKAEASNAAQETELSKDPIAEEIEFDDFAKVDLRIAKI
VSCESVPKADKLLKFQLDIGGEMRQVFSGIKAAYNPEDLVGKYTVVVANLKPRKMKFGMS
EGMILAAGPGGKDLWILEPHEGAQPGMRVM
Download sequence
Identical sequences A0A0H0Y319 A0A2J9VWR8 Q7MM14
gi|37679443|ref|NP_934052.1| 196600.VV1259 WP_011149956.1.16238 WP_011149956.1.21633 WP_011149956.1.22486 WP_011149956.1.22778 WP_011149956.1.25536 WP_011149956.1.28571 WP_011149956.1.30871 WP_011149956.1.33883 WP_011149956.1.34622 WP_011149956.1.47396 WP_011149956.1.54486 WP_011149956.1.55006 WP_011149956.1.58885 WP_011149956.1.73066 WP_011149956.1.73173 WP_011149956.1.79678 WP_011149956.1.81460 WP_011149956.1.8379 WP_011149956.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]