SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011149965.1.34622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011149965.1.34622
Domain Number 1 Region: 96-312
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.72e-65
Family Pseudouridine synthase RsuA/RluD 0.000000089
Further Details:      
 
Domain Number 2 Region: 19-71
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000379
Family Ribosomal protein S4 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011149965.1.34622
Sequence length 315
Comment 23S rRNA pseudouridine(955/2504/2580) synthase [Vibrio vulnificus]; AA=GCF_000009745.1; RF=na; TAX=196600; STAX=672; NAME=Vibrio vulnificus YJ016; strain=YJ016; AL=Complete Genome; RT=Major
Sequence
MNEIRTKVQIVDIDEDMAGQRIDNFLRNQLKDVPKSMIYRIVRKGEVRVNKKRVKAEYKL
AAGDIVRIPPVTLEKKDPETAPSTKLNKVAELQDLIIYEDDHLLVLNKPSGTAVHGGSGL
KFGAIEALRALRPEARFLELVHRIDRDTSGILLVAKKRSALRHLQAQFREKTVQKYYFAL
VMGEWENSCKVVNAPLLKNEVNSIVRVNPNGKPSETRFKVIEKFPQATLVQASPITGRTH
QIRVHTQYSGHPIAWDDRYGDRRFDAYTAQHGLNRLFLHAANIRFTHPATEQIMEINAPM
GELLEKVVQSLRTSR
Download sequence
Identical sequences Q7MM05
gi|37679452|ref|NP_934061.1| WP_011149965.1.34622 196600.VV1267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]