SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011150063.1.16238 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011150063.1.16238
Domain Number 1 Region: 2-197
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.5e-44
Family Pseudouridine synthase RsuA/RluD 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011150063.1.16238
Sequence length 231
Comment RNA pseudouridine synthase [Vibrio vulnificus]; AA=GCF_001675245.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=FORC_017; AL=Complete Genome; RT=Major
Sequence
MFDILFTHPDFLIINKYPHVSVHKDDGDTMLLQEVAKVSGDEQLYLIHRLDKMTSGILLL
GRNSTAASALSQRFAQREVEKFYLAIGAKKPKKKQGTVIGDMERSRRASWKLVNSKQNPA
ITQFFSLAGEPGERAFLCKPYTGKTHQIRVALKSVGSSIIGDPIYNAGSDSDRGYLHAFC
LGFQYQGEQYHFVCDPRNQPALGEKWNSEALNQAIEQWLTPWQLNWPTINK
Download sequence
Identical sequences Q7MLM4
196600.VV1403 gi|37679587|ref|NP_934196.1| WP_011150063.1.16238 WP_011150063.1.34622 WP_011150063.1.93668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]