SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011151015.1.58885 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011151015.1.58885
Domain Number 1 Region: 26-235
Classification Level Classification E-value
Superfamily CorA soluble domain-like 1.44e-29
Family CorA soluble domain-like 0.0092
Further Details:      
 
Domain Number 2 Region: 246-306
Classification Level Classification E-value
Superfamily Magnesium transport protein CorA, transmembrane region 0.00000000000275
Family Magnesium transport protein CorA, transmembrane region 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011151015.1.58885
Sequence length 309
Comment zinc transporter ZntB [Vibrio vulnificus]; AA=GCF_000746665.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=93U204; AL=Complete Genome; RT=Major
Sequence
MGFLIDHWDFSTTPASQPDNNFQTIKANHWYHCERHHPDIRTWLLENQVPLSTVNHLLAD
ETRPSFHRYDDDSFMLILRGVNMNENAVPEDMLSIRILYFNGTLISTRKTSSKAISEIRE
ALVEQKGPAAIADLLLAIVDGLTGKMQHYLLDIEEQIEQFELDTDQIGDIIEVQKALLRI
KRFIRPQQYAIADFAMAELGLLEKKQLMLNYALSNITRINETIDFFLGELALLKEQIQQL
REDKISRNSYLFTLIASIFLPTSFLTGLLGINIGGIPGVESPLAFLWFCIGLVVIFAAEV
LLLKRLKFW
Download sequence
Identical sequences Q7MI90
196600.VV2627 gi|37680811|ref|NP_935420.1| WP_011151015.1.16238 WP_011151015.1.21633 WP_011151015.1.22778 WP_011151015.1.34622 WP_011151015.1.58885 WP_011151015.1.66581 WP_011151015.1.81460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]