SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011151221.1.34622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011151221.1.34622
Domain Number - Region: 148-225
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0232
Family Matrix metalloproteases, catalytic domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011151221.1.34622
Sequence length 331
Comment MULTISPECIES: Zn-dependent protease [Vibrio]; AA=GCF_000009745.1; RF=na; TAX=196600; STAX=672; NAME=Vibrio vulnificus YJ016; strain=YJ016; AL=Complete Genome; RT=Major
Sequence
MRIFGTAFPPRSSERCEAEIDTSQPHLLALHVNGEIFSADYHYLHISEPVGRLPVRISFP
NGWVFITEPSTALSKWLGFHKKQSFVDRMEGNIPAWILSAMVCLAVIAGCYYYLLPWGSQ
KIAESLPDSLSIAVGKQVLDSLDLQLEPSQLPEEQQSAIRQRVQQFAQVLPELPYDIKVE
FRSMPEGANAFALPGGTIVLLDELVALAQTQQQLDSIILHEMGHVHHRHMMKQVVHSTIL
SVAVSLITGESSGIVDNLAGVGVFIVSNGQSREAETQADLYAKKAMKQIYGTSEPLAEMF
ELFQTQEMMDIPEWFSSHPNFSERIQAAREE
Download sequence
Identical sequences A0A1L9KPQ8 Q7MHG0
WP_011151221.1.34622 WP_011151221.1.94371 196600.VV2911 gi|37681095|ref|NP_935704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]