SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011151438.1.93668 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011151438.1.93668
Domain Number 1 Region: 10-360
Classification Level Classification E-value
Superfamily Tryptophan synthase beta subunit-like PLP-dependent enzymes 3.67e-107
Family Tryptophan synthase beta subunit-like PLP-dependent enzymes 0.000000000501
Further Details:      
 
Domain Number 2 Region: 332-418
Classification Level Classification E-value
Superfamily ACT-like 5.8e-27
Family Allosteric threonine deaminase C-terminal domain 0.0000781
Further Details:      
 
Domain Number 3 Region: 415-508
Classification Level Classification E-value
Superfamily ACT-like 2.13e-26
Family Allosteric threonine deaminase C-terminal domain 0.0000819
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011151438.1.93668
Sequence length 509
Comment MULTISPECIES: PLP-dependent threonine dehydratase [Vibrio]; AA=GCF_002117205.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=FORC_036; AL=Complete Genome; RT=Major
Sequence
MSLTQQTGADYLRQILRAPVYEVATVTPLQEMPRLSARIGNNVQIKREDRQPVHSFKLRG
AYNMVANLSQAQKDAGVIAASAGNHAQGMALSGTRLGIETTIVMPRTTPDIKVDAVRGFG
GKVVLHGSNFDEAKAEAERLSQEKGYTFVPPFDHPLVIAGQGTIGMEMLQQNGHLDHIFV
PVGGGGLAAGVAVLVKQLMPEIKVIAVEPEDSACLKAALDAGEPVVLDQVSMFADGVAVK
RIGDETFRLCQHYIDDHVTVSSDEICAAVKDIFEDTRAIAEPSGALALAGLKKYAEKHKL
KGHNLGTVLSGANTNFHGLRYVSERCELGEKREGLLAVTIPERKGAFFEFCHLIGGRAVT
EFNYRYNDDSLANIFVGVRLQNGQEELDGIIRDLREGGYPVVDLSEDEMAKLHVRYMIGG
KPSKPLKERLYSFEFPEYPGALLKFLSTLGTHWNISLFNYRNHGADYGRVLCGFELDESD
LSRFSAHLRELGYQCKDVTDNPSYRFFLS
Download sequence
Identical sequences A0A0H0XRY9 A0A1L9KPD2 A0A1W6M8C1 Q7MGI7
gi|320154865|ref|YP_004187244.1| 196600.VV3244 WP_011151438.1.16238 WP_011151438.1.21633 WP_011151438.1.22486 WP_011151438.1.22778 WP_011151438.1.25536 WP_011151438.1.33883 WP_011151438.1.34622 WP_011151438.1.53345 WP_011151438.1.54486 WP_011151438.1.55006 WP_011151438.1.58885 WP_011151438.1.66581 WP_011151438.1.73066 WP_011151438.1.73173 WP_011151438.1.79678 WP_011151438.1.81460 WP_011151438.1.8379 WP_011151438.1.90288 WP_011151438.1.93668 WP_011151438.1.94371 WP_011151438.1.9921 WP_011151438.1.99976 gi|37681428|ref|NP_936037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]