SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011152582.1.8379 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011152582.1.8379
Domain Number 1 Region: 7-326
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.25e-100
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000206
Further Details:      
 
Domain Number 2 Region: 324-418
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000000000000222
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011152582.1.8379
Sequence length 422
Comment tyrosine--tRNA ligase [Vibrio vulnificus]; AA=GCF_001889185.1; RF=na; TAX=672; STAX=672; NAME=Vibrio vulnificus; strain=S2-22; AL=Scaffold; RT=Major
Sequence
MNSQLLFDDLAQRGLIAQTTDLEQLIALFRQPQTLYCGFDPTAGSLHIGHLVPLIMLKRF
QDAGHQGIALIGGATGMIGDPSFKASERSLNSAETVAAWVNALATQIQQLMTPHLTQPLV
MVNNADWMQSIGVIAFFRDIGKHFSVNAMIQRESVKQRLARPDQGISFTEFSYSLLQSYD
FAQLNQTHQCALQIGGNDQWGNIVSGIDLTRRLNGTTVHGLTLPLITKSDGTKFGKTEGG
AIWLDAAKTSPYMFYQFWLNCDDADVYRFLRYYTFLSVEQIEQIEATDKAQVGKPSAQRI
LAEEMTRFVHGHAGLESAQRISQALFSGQLNQLNLAELKQLEQDGLPCRQLAHVSDVVTL
LLETGLASSKRQAREWLENGAIRINGERWNEQTLAQTFALYDQYYIVQRGKKQFAMVKLA
QV
Download sequence
Identical sequences A0A1W6MC19 Q7MCN7
WP_011152582.1.25536 WP_011152582.1.34622 WP_011152582.1.73066 WP_011152582.1.81460 WP_011152582.1.8379 WP_011152582.1.90288 WP_011152582.1.93668 gi|320159093|ref|YP_004191471.1| gi|37677009|ref|NP_937405.1| 196600.VVA1349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]