SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011152690.1.34622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011152690.1.34622
Domain Number 1 Region: 1-301
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.34e-47
Family FAD-linked reductases, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011152690.1.34622
Sequence length 400
Comment hydroxyglutarate oxidase [Vibrio vulnificus]; AA=GCF_000009745.1; RF=na; TAX=196600; STAX=672; NAME=Vibrio vulnificus YJ016; strain=YJ016; AL=Complete Genome; RT=Major
Sequence
MYDFIVVGGGIVGVSTAWQLQQRYPEKSVLLVEKESGFAHHQTGHNSGVIHAGVYYAPGS
LKADFCKRGVEATKAFCAKHKIPVENCGKLLVATTAAEVERMNALYERCHVNGIEVELLD
AAQLKLAEPNIVGLGAIYVKSTSIVDYRLVTEKMAQELVDLGGEVRLNAKVIALEEHADE
VQVTCECAGETLQLNGRFLISCGGLMADRLTKMLGIETDFQIIPYRGEYYQLPSKHNQVV
KHLIYPIPDPDLPFLGVHLTRMIDGSVTVGPNAVQGWKREGYGRVNFSIQDTWQMLRFAG
FWKVTKQHFATGVKEFINSWWKAGYLKLVNKYCPMIQVEDLQPYPAGIRAQAVLSDGSLV
HDFLFAESPRSLHVCNAPSPAATSAMPIGEYICNKVEAKL
Download sequence
Identical sequences Q7MCB2
WP_011152690.1.34622 gi|37677135|ref|NP_937531.1| 196600.VVA1475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]