SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011161544.1.27409 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011161544.1.27409
Domain Number - Region: 144-226
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.016
Family Capz alpha-1 subunit 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011161544.1.27409
Sequence length 502
Comment accessory Sec system protein Asp1 [Lactobacillus johnsonii]; AA=GCF_000008065.1; RF=na; TAX=257314; STAX=33959; NAME=Lactobacillus johnsonii NCC 533; strain=NCC 533; AL=Complete Genome; RT=Major
Sequence
MKYFIPAWHKQYDDWSINIPSIENYDAAEYMTVLKKFDEEIGLIITDYQSQLLSKLNQIA
FFPNTLFSVYDFLQGVHGFENKVLELEDFNWPKNAIFDYGPFRTLIVLENKLYATVFYDI
DGHILRISYPENDEHKAFTLGIDSRGFISNQDDEEKTIYFDPYGNWRFKKDKTTDKITVN
PEMHFCKRREYENITDLVDEILSRYLKVNAKNNDEIIVTVDDESSFNNEIIEPYKPLYII
NRHHPYSKKIGSLARAKVIVSSNEIKQNLEKNYREQFDISVIPVFNSEFRLGHSQRQNVQ
EIGFFAENANDENIHQIIQKLCNYILKNPDNYSLKIFTYNFWKADHVNKILEQIKEENKN
SFILGKSEQAENAPIDGLDDEVSLPELDVAHTRLTNISDVLSNLDKMRLLINWGKADELM
QISGVSIGIPQVQNFSSVTVVDNKNGRIIKKISELLPVVDEYLTNLNSWNQTVVYNVQLM
NQYSEENIIEKWKEVFKERKAE
Download sequence
Identical sequences Q74L40
gi|42518479|ref|NP_964409.1| 257314.LJ0385 WP_011161544.1.27409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]