SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011164731.1.54414 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011164731.1.54414
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.81e-16
Family Clp protease, ClpP subunit 0.051
Further Details:      
 
Domain Number 2 Region: 356-422
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000183
Family NfeD domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011164731.1.54414
Sequence length 424
Comment hypothetical protein [Bdellovibrio bacteriovorus]; AA=GCF_000691605.1; RF=na; TAX=959; STAX=959; NAME=Bdellovibrio bacteriovorus; strain=109J; AL=Complete Genome; RT=Major
Sequence
MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKRAVEDKCSSLYLRINT
PGGSLQSTRLIVERILASPVPYLCLIAPRGGHAGSAGAIILQACHVNGGMTATNIGAATP
ILGTGEKTPEDLRKKLINDTVSWMEGVTKLRGRSLKFSKEIITEAKSLSSEVAHAEGALD
ILAATELEFLQQAQGRKVVVGEKKEPSVVAVHDLREFVPDLRYKVLSFIADPEFAYLLFM
GSLALLYVEVTNPGLIAPGVIGGIGLVLSMVAFHKLDVAWGGLALILLGVAFLIAEMFIP
SFGALGIGGLIAVFVGSVFLFDAQTTGYTLPISLIVSVVGVLGIFFLGLGYLAVKTIRLR
TQDTDAQMQSRDGIVMTVEGNGHSGQVEIIGEIWKFVSEDSLAPGDRVHITGRQGLTLNV
KKNK
Download sequence
Identical sequences Q6MKS8
264462.Bd2305 WP_011164731.1.10133 WP_011164731.1.54414 gi|42523756|ref|NP_969136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]