SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011166566.1.32010 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011166566.1.32010
Domain Number 1 Region: 6-144,283-356
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000537
Family GidA-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011166566.1.32010
Sequence length 424
Comment methylenetetrahydrofolate-tRNA-(uracil-5-)-methyltransferase [Mycoplasma mycoides]; AA=GCF_001554055.1; RF=na; TAX=2103; STAX=2102; NAME=Mycoplasma mycoides subsp. mycoides; strain=Ben1; AL=Complete Genome; RT=Major
Sequence
MKTIRIIGAGLSGCEAAYYLLKKGYFVELYEIKTIKKNPIQHYDYFCELAYSDSFRSTDL
NTSVGTLKKELELLDSLIIKAAKYASINQNNELVVNRIEFSKYITNYLKTFNNLKIIEQE
YLNIDLNIPTIIAIGPISTPSFLTNLKKIINKKNLKLFDTVEPTILKQSINKNICYSLDN
NLDYLYCDLNKEQFEKFYNALISAKTFNSPLKNEIKLLEKNNYFSIESLAKNKQEFINHF
KPINNNAYITITLKKDSVIDNLYTIVNFQTSLMWNEQLKVFSLIPGLENLKIMRYGVMHK
NNYINTKKLLNLGVQLKTNKNIFFAGQIIGVDGYVESVCSGLISAINLDRYLNNKKMILP
NKNSTIGSLYNYLLKTDSNFNPMRINWALVDLIDGFELSDNSKKFYSKRAIELIKQYLKK
INYK
Download sequence
Identical sequences A0A0F2BQP0 Q6MTM6
NP_975368.1.55851 WP_011166566.1.11018 WP_011166566.1.17500 WP_011166566.1.32010 WP_011166566.1.3214 WP_011166566.1.37196 WP_011166566.1.51345 WP_011166566.1.72634 WP_011166566.1.84266 gi|479184203|ref|YP_007811186.1| 272632.MSC_0375 gi|42560917|ref|NP_975368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]