SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011166677.1.51345 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011166677.1.51345
Domain Number 1 Region: 1-207
Classification Level Classification E-value
Superfamily CutC-like 4.18e-45
Family CutC-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011166677.1.51345
Sequence length 227
Comment copper homeostasis protein [Mycoplasma mycoides]; AA=GCF_000143865.1; RF=na; TAX=865867; STAX=2102; NAME=Mycoplasma mycoides subsp. mycoides SC str. Gladysdale; strain=Gladysdale; AL=Complete Genome; RT=Major
Sequence
MFLEVIAKDLSDIRVINNSKADRIEFCKNLEVGGLTPSLDEIILANQITLKPLHIMIRNN
SKDFFFDDYELIKQLEMISVIQKLPNVHGIVIGALNNDYTINEDFLQRVNKIKGSLKITF
NRAFDLVKDPINALNVLAKHKIDAVLTSGGTNLNTGLEVIRQLVDQNLDIQILIGGGVDK
NNIKQCLTVNNQIHLGRAARMNSSWNSDISVDEINLFKDLDREQNNE
Download sequence
Identical sequences A0A0F2BLY1 Q6MTB5
gi|42561028|ref|NP_975479.1| NP_975479.1.55851 WP_011166677.1.11018 WP_011166677.1.17500 WP_011166677.1.32010 WP_011166677.1.3214 WP_011166677.1.37196 WP_011166677.1.51345 WP_011166677.1.72634 WP_011166677.1.84266 272632.MSC_0493 gi|479184288|ref|YP_007811312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]