SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011166681.1.11018 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011166681.1.11018
Domain Number 1 Region: 153-292
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000428
Family HD domain 0.032
Further Details:      
 
Domain Number 2 Region: 2-93
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000195
Family Single strand DNA-binding domain, SSB 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011166681.1.11018
Sequence length 326
Comment hypothetical protein [Mycoplasma mycoides]; AA=GCF_001564435.1; RF=na; TAX=2103; STAX=2102; NAME=Mycoplasma mycoides subsp. mycoides; strain=T1/44; AL=Complete Genome; RT=Major
Sequence
MKKVKDINIEDHLIDTILRIERVIVSTGSSGNNYLILHLADSTGRIEARKWVVSEKDKQL
LKPNTIVLLKDTIVHEYRNILQLKVEDYQVIDEKDLLKYHLNKTDLYITAPLDIKTSYLE
LISLLNSINNQTYKTITLNLIEKYKKEFLTFPAAMSIHHNVTSGLFWHSYTLVKNVLSLK
ENYFYVNIDWDLLICGAILHDIGKVIEISDVNGSDYSLEGKLLGHISIGNAEINKLADKL
NLYKDQNNKINKEITLLQHMILASHGKKEFGSPIEPVLIEAVILSALDDLDAKVYKINDE
LSKIELDNWTQKIISIDNKMFYKHKK
Download sequence
Identical sequences A0A0F2BQD0 Q6MTB1
NP_975483.1.55851 WP_011166681.1.11018 WP_011166681.1.17500 WP_011166681.1.32010 WP_011166681.1.3214 WP_011166681.1.37196 WP_011166681.1.51345 WP_011166681.1.72634 WP_011166681.1.84266 gi|479183900|ref|YP_007811316.1| 272632.MSC_0497 gi|42561032|ref|NP_975483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]