SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011166792.1.37196 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011166792.1.37196
Domain Number 1 Region: 4-197
Classification Level Classification E-value
Superfamily ITPase-like 2.12e-54
Family ITPase (Ham1) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011166792.1.37196
Sequence length 200
Comment non-canonical purine NTP pyrophosphatase [Mycoplasma mycoides]; AA=GCF_000959055.1; RF=na; TAX=2103; STAX=2102; NAME=Mycoplasma mycoides subsp. mycoides; strain=B237; AL=Contig; RT=Major
Sequence
MDKKVIYLATTNKNKVKEFSEILKDYQIKSLLDIPEYVEIEENKKTFKQNALLKAKHLAK
YINGVAIGDDTGICVKALNDFPGIYSKRWAYPLTNHYDICNKLLDKLKHINQLNKRKAYM
TTAIALYDAINKKQFVYQARVNGYIDFQVNESEFGFGYDFIFIPKGYDKAYSLMNSELKN
QISARKKAIDKLIEYIDNVK
Download sequence
Identical sequences A0A0F2BP02 Q6MT00
gi|479184184|ref|YP_007811437.1| gi|42561145|ref|NP_975596.1| NP_975596.1.55851 WP_011166792.1.11018 WP_011166792.1.17500 WP_011166792.1.32010 WP_011166792.1.3214 WP_011166792.1.37196 WP_011166792.1.51345 WP_011166792.1.72634 WP_011166792.1.84266 272632.MSC_0616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]