SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011170798.1.41672 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011170798.1.41672
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily GlnB-like 6.04e-34
Family Prokaryotic signal transducing protein 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011170798.1.41672
Sequence length 105
Comment nitrogen fixation nifHD region glnB 1 [Methanococcus maripaludis]; AA=GCF_000220645.1; RF=representative genome; TAX=1053692; STAX=39152; NAME=Methanococcus maripaludis X1; strain=X1; AL=Complete Genome; RT=Major
Sequence
MKMIRAVVRPSKAEEVVDALAESGCVALTKMDVIGRGKQKGIKIDQIYYDELPKTMLMLV
VEDDAAENVIELITKTAYTGSFGDGKIFVSPVDEAYTVRTRSCGL
Download sequence
Identical sequences G0GZY1 P0CW45
gi|340624152|ref|YP_004742605.1| 267377.MMP0854 gi|45358417|ref|NP_987974.1| WP_011170798.1.40991 WP_011170798.1.41672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]