SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011171222.1.40991 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011171222.1.40991
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily GlnB-like 8.89e-27
Family DUF190/COG1993 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011171222.1.40991
Sequence length 109
Comment hypothetical protein [Methanococcus maripaludis]; AA=GCF_000011585.1; RF=na; TAX=267377; STAX=39152; NAME=Methanococcus maripaludis S2; strain=S2; AL=Complete Genome; RT=Major
Sequence
MKKISAKLLRIYLKEEDKYGKELLINSIIKTLKTNGIAGATVFKGFCGYGTRGISRIDIL
RLSMNLPAVIECIDYEEKLNDIMPKLVEMVSENGLITIQDIDVFKELKK
Download sequence
Identical sequences Q6LXS0
WP_011171222.1.40991 267377.MMP1278 gi|45358841|ref|NP_988398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]