SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011173249.1.85415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011173249.1.85415
Domain Number 1 Region: 389-514
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.19e-21
Family Histidine kinase 0.016
Further Details:      
 
Domain Number 2 Region: 180-326
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000294
Family GAF domain 0.0078
Further Details:      
 
Weak hits

Sequence:  WP_011173249.1.85415
Domain Number - Region: 327-401
Classification Level Classification E-value
Superfamily AF1862-like 0.0693
Family Cas Cmr5-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011173249.1.85415
Sequence length 515
Comment sensor histidine kinase [Thermus thermophilus]; AA=GCF_000008125.1; RF=na; TAX=262724; STAX=274; NAME=Thermus thermophilus HB27; strain=HB27; AL=Complete Genome; RT=Major
Sequence
MTEHSLYRLVRLAQRLLPPAIALVVLAFELALSPFDHTSALFWLRLGFYGLVGPLVTYAV
LEWIAQEVLEKARAERALEEANRRLLASERVFREALASENLEEAVLRIARGLEETLGYPV
ALEAEGVRSGKGCGGRRVALPGLKGYLEACGDGTDQVFLEVLAHEVAGALQAVVARSRDL
LTLFEVDQALKAEANLDRLLEGLLDRIRAWAGAEGGGVLLLDEEGFLLARVVQGLALPSH
PFLPEGAWKAALQGPVFVEKGVLALPLKAREPVGVLVLKGEDLSRRIPFLSFLASQVALA
VRNAQAYLKAEELAINEERTRIAREIHDGLAQSLAFMALKLDLVERLWEKDKGAALGALA
EVRETLRAQIREVRRSIFALRPIDLERYGFLESLRRYAQAFAEQAGFRVQLSLPERVGLS
QASELVLFRVLQEALTNAAKHARPTRVEVVLEPLGERGARLVVRDNGRGFAVPEAQGLGG
FGLTQMRERVEARGGRFWVVSAPGRGTEVGAEVPY
Download sequence
Identical sequences Q72JF5
WP_011173249.1.85415 gi|46199123|ref|YP_004790.1| 262724.TTC0817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]