SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011192515.1.42361 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011192515.1.42361
Domain Number 1 Region: 794-1164
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.42e-117
Family PFOR PP module 0.0000000411
Further Details:      
 
Domain Number 2 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.35e-73
Family PFOR Pyr module 0.0000000865
Further Details:      
 
Domain Number 3 Region: 417-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.62e-73
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000001
Further Details:      
 
Domain Number 4 Region: 255-410
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.14e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000189
Further Details:      
 
Domain Number 5 Region: 665-837
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.65e-22
Family Ferredoxin domains from multidomain proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011192515.1.42361
Sequence length 1177
Comment MULTISPECIES: pyruvate:ferredoxin (flavodoxin) oxidoreductase [Yersinia]; AA=GCF_000511675.1; RF=na; TAX=1218101; STAX=633; NAME=Yersinia pseudotuberculosis NBRC 105692; strain=NBRC 105692; AL=Contig; RT=Major
Sequence
MITTDGNSAVASVAYRASEVIAIYPITPSSTMAEQADAWSGDGKVNIWGDVPRVVEMQSE
GGAIATVHGALQTGALSTSFTSSQGLLLMIPTLYKLAGELTPFVLHVAARTIATHALSIF
GDHSDVMAVRQTGCAMLCASSVQEAQDFALISQIATLNSRIPFIHFFDGFRTSHEINKIE
PLSDETLRQLLPQAGINAHRSRALSPDHPVVRGTSANPDTYFQSREATNPWYNNTYQHVA
DAMQAFAEATGREYKPFEYYGHPQADRVIILMGSAIGTCEEVIDTLLTRGEKVGVLKVRL
FRPFSAQHLLALLPASVGKIAVLDRTKEPGALAEPLYLDVMTALAEAYSRGDRDTLPKVI
GGRYGLSSKEFGPHCVLAIFRELSLDLPRPRFTVGIFDDVTGLSLPLSDEKIESRATLEA
LFYGLGSDGSVSATKNNIKIIGNSTALYAQGYFVYDSKKAGGLTVSHLRVSQTPINSAYL
VSHADFVGCHQLQFIDIYQMAERLKPGGIFLLNTPFSADEMWPRLPQDVQAVLHQRHARL
FVINAAKIARECKLGARINTVMQMAFFHLTQILPTAMAQEQLRAAIERSYSNKGAEIVTR
NWQALDATLEALIEIPLQPIDENSPVRPPIVSDQAPDFVKTVTATMLAGLGDTLPVSAFP
PDGTWPVGTTQWEKRNIAENIPIWQPDLCTQCNHCVAACPHSAIRAKVVQPEAMAGAPDS
LQSLDVKARDMRGQKYVLQVAPEDCTGCNLCYEVCPAKDRQNPEIKAINMRPRLEHRAVE
KAHYDFFLKLPEIDKTQMERIDIRTSQLISPLFEYSGACSGCGETPYIKLLTQLYGDRLL
IANATGCSSIYGGNLPTTPYTTNADGRGPAWANSLFEDNAEFGLGFRLTVDQHQKRVTRL
IQQLAPQLPDELVNQLINQEYTPEERRKQVSQLRQLLREIPGNDAQQLAADADYLVDKSI
WLIGGDGWAYDIGFGGLDHVLSLTENVNVLVLDTQCYSNTGGQQSKATPLGAVTKFGEHG
KRKARKDLGVSMMMYGHVYVAQISIGAQLNQTVKAIQEAEAYPGPSLIIAYSPCEEHGYD
LAYSHDQMKQLTATGFWPLYRFDPRRADEGKTALALDSRPPSSDLTTTLLNEQRFRRLNT
QEPAVAAQLYAEAEKDLKKRYDFLSLLAGKTEKTPSE
Download sequence
Identical sequences A0A0U1EMS4 A0A0U1QYK8 Q66A79
273123.YPTB2253 349747.YpsIP31758_1803 502801.YPTS_2329 gi|51596577|ref|YP_070768.1| gi|153948855|ref|YP_001400778.1| WP_011192515.1.12167 WP_011192515.1.14169 WP_011192515.1.20380 WP_011192515.1.20932 WP_011192515.1.26383 WP_011192515.1.32736 WP_011192515.1.33324 WP_011192515.1.39858 WP_011192515.1.42361 WP_011192515.1.46697 WP_011192515.1.47769 WP_011192515.1.50185 WP_011192515.1.52473 WP_011192515.1.53883 WP_011192515.1.58543 WP_011192515.1.6333 WP_011192515.1.63641 WP_011192515.1.6791 WP_011192515.1.75208 gi|186895635|ref|YP_001872747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]