SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011192654.1.50185 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011192654.1.50185
Domain Number 1 Region: 108-307
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.22e-51
Family D-glucarate dehydratase-like 0.000000147
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.77e-28
Family Enolase N-terminal domain-like 0.0000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011192654.1.50185
Sequence length 323
Comment o-succinylbenzoate synthase [Yersinia pseudotuberculosis]; AA=GCF_000834295.1; RF=na; TAX=273123; STAX=633; NAME=Yersinia pseudotuberculosis IP 32953; strain=IP32953; AL=Complete Genome; RT=Major
Sequence
MRTATLYRYSVPMEAGVILRHQRLKSRDGLLVKLQQGELSGWGEIAPLPEFSQETLDQAQ
VAAECWLQHWVSGVESDDSVLPSVAFGLSCAQAELKQTLPLSADYRKASLCTGDPDELFA
VLQALPGEKVAKVKVGLYEAVRDGMIVNVLLEALPDLTLRLDANRSWSRAKADGFAKYVN
PALRSRIAFLEEPCKTRAESREFAQDTGIAIAWDESVREADFQVEAEPGVAAIVIKPTLV
GSLARCQQLVQQAHQAGLVAVISSSIESSLGLTQLARLAAWLTPATVPGLDTLDLMQAQV
VRPWPDSPLPLITTEQLGVVWHR
Download sequence
Identical sequences Q669D0
WP_011192654.1.26383 WP_011192654.1.50185 gi|51596876|ref|YP_071067.1| 273123.YPTB2557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]