SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011193129.1.32736 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011193129.1.32736
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.05e-111
Family FMN-linked oxidoreductases 0.000000000338
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 4.71e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000287
Further Details:      
 
Domain Number 3 Region: 461-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.62e-22
Family C-terminal domain of adrenodoxin reductase-like 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011193129.1.32736
Sequence length 673
Comment MULTISPECIES: NADPH-dependent 2,4-dienoyl-CoA reductase [Yersinia]; AA=GCF_900092345.1; RF=na; TAX=633; STAX=633; NAME=Yersinia pseudotuberculosis; AL=Complete Genome; RT=Major
Sequence
MLAYPHLFTPLDLGFTTLKNRILMGSMHTGLEELPDGPQRLAAFYAERAAGGVGLIVTGG
IAPNMKGVVYQGASVLNDAAQIPHHQVVTEAVHQAGGKIALQILHAGRYSYQKHPVAPSA
LQAPINPFVPQALSHEEILQTIADFAHCAQLAKQAGYDGVEIMGSEGYLINQFLTARTNQ
RDDEWGGDFTHRMRFAVEIVRAVRQATGHDFILIYRLSMLDLVEEGSNWVEIEQLAQAVE
QAGATVINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKVNIPLITTNRINDPAVAEQV
LADGCADMVSMARPFLADAAFVQKAVQGRADEINTCIGCNQACLDQIFDGKLTSCLVNPR
ACRETEMPELPTDAPKRLAVVGAGPAGLAFAVTAARRGHQVTLFDAAAEIGGQFNIAKQI
PGKEEFYETLRYFRRQLVLNGVTLQLNTLVQVKQLAEFDEVILACGIQPRLPCINGIDHP
KVLTYLDVLRDKKPVGQRVAIIGAGGIGFDTAEYLSQSGDSPRFDSTAFSTEWGIDQDLA
HRGGLSPAGAKVPPSPRQIFLLQRKASKVGEGLGKTTGWIHRTSLAMRGVKMLNSVSYEA
IDDKGLHIIRAEQACCLPVDTIIICAGQEPRRELHQPLLDMGKTVYLIGGADKAVELDAR
RAIDQGTRLALAI
Download sequence
Identical sequences A0A0U1EUD2 Q665P7
gi|186896952|ref|YP_001874064.1| gi|51597761|ref|YP_071952.1| WP_011193129.1.20932 WP_011193129.1.26383 WP_011193129.1.32736 WP_011193129.1.33324 WP_011193129.1.46697 WP_011193129.1.50185 WP_011193129.1.53883 WP_011193129.1.63641 WP_011193129.1.6791 WP_011193129.1.75208 WP_011193129.1.83630 273123.YPTB3469 502801.YPTS_3654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]