SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011210005.1.97239 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011210005.1.97239
Domain Number 1 Region: 81-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000248
Family NfeD domain-like 0.006
Further Details:      
 
Weak hits

Sequence:  WP_011210005.1.97239
Domain Number - Region: 17-65
Classification Level Classification E-value
Superfamily Htr2 transmembrane domain-like 0.0628
Family Htr2 transmembrane domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011210005.1.97239
Sequence length 143
Comment membrane protein [Nocardia farcinica]; AA=GCF_001612925.1; RF=na; TAX=1210076; STAX=37329; NAME=Nocardia farcinica NBRC 15532; strain=NBRC 15532; AL=Contig; RT=Major
Sequence
MAAIAWLVAGILLAAAEMLVGDLTLLMIGVAALGTAGVSAAADTSVIVDAVVFGVITLVL
LLGVRPVLRRRFGTPPPVPTNVHALPGKTALVLEEVTDTAGLVKLAGEVWTARPMNQGDV
FEPGTTVSVMEIDGATAVVWKGP
Download sequence
Identical sequences A0A0H5NEG1 A0A2A7UE17 Q5YU21
gi|54025442|ref|YP_119684.1| 247156.nfa34720 WP_011210005.1.31130 WP_011210005.1.72093 WP_011210005.1.78782 WP_011210005.1.85486 WP_011210005.1.97239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]