SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011223811.1.69175 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011223811.1.69175
Domain Number 1 Region: 580-662
Classification Level Classification E-value
Superfamily PKD domain 0.00000000222
Family PKD domain 0.0038
Further Details:      
 
Domain Number 2 Region: 313-392
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000102
Family Invasin/intimin cell-adhesion fragments 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011223811.1.69175
Sequence length 664
Comment hypothetical protein [Haloarcula marismortui]; AA=GCF_000011085.1; RF=na; TAX=272569; STAX=2238; NAME=Haloarcula marismortui ATCC 43049; strain=ATCC 43049; AL=Complete Genome; RT=Major
Sequence
MTFMGDERAQSVQVGAVLLFGVLIIAFSSYQAFAVPEQNQEVEFNHNQQVQTQLQDLRNA
IVSVPGQPSRQAVSVQLGTRYPSRLVATNPGPPSGLLYTDGTSNESQNLTIRNAEARTPE
TADYWDGTTPRHYNTGAIAYKPEYNVYGEAPETVYEHSVVYNQFREGNITLSEQTMVDGR
DITLVTLNGSMSRSTSDSVTVDVEPKSQSSRTVRVTNTTATSNVSVSFLSRLPEEEWRVI
LEDEIDPNPGDKGNEQYVASVTGAEGPGSLYNITIVFERDTTYRLKMAKAGVGSGDTDES
EAYLTTVGSEEITVARGNSKEIVLEVRDAYNNPVSDVEVNGSVDGSNAGSLTTDTESSDS
DGRVRFVYETSQSTATGTATVQFSLDEINGSFDGESPEDVSVPVTVTEANPGSGGGSGNS
GLIYNDDAFALDSDGSIDGGVQFTVTNELGETITITTVAIDPVDDQIDYLSDNTAGFLER
SPQETELYIEADSNGYTDLGTGASIPRIIDVDGDSSYFSGSNPILADSSTATFHLFEFGD
GNNEKNMNGESVTITVTYELSSGGTGSKMFTIIPGGANTNEQPNADFTIDSSGGSGNLKF
DANPSSDPQGDIVTYEWDFDGDGIFETETNKEKINTKSVSSDTTVALRVVDSEGNADTVR
KEVP
Download sequence
Identical sequences Q5V1G3
WP_011223811.1.69175 gi|55378495|ref|YP_136345.1| 272569.rrnAC1737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]