SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011229647.1.100150 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011229647.1.100150
Domain Number 1 Region: 4-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.07e-66
Family ABC transporter ATPase domain-like 0.0000681
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011229647.1.100150
Sequence length 279
Comment MULTISPECIES: energy-coupling factor transporter ATPase [Geobacillus]; AA=GCF_000447395.1; RF=na; TAX=1095383; STAX=1095383; NAME=Geobacillus sp. A8; strain=A8; AL=Contig; RT=Major
Sequence
MAEPILSIEGVSFRYPNQSDYAVQNVSFTAERGEWLAIVGHNGSGKSTIARMLIGLLRPE
RGAIRLFGRLLNDATVWEVRRRVGLVFQNPDNQFVGATVEDDIAFALENNGIPRLEMVER
IREAIRQVHMEPFLHYEPHRLSGGQKQRVAIAGILALRPDMIILDEATSMLDPRGREEVL
ETVRRLNRQQRITVLSITHDLEEAAKADRLIVMNKGEVMAEGTPEQIFRLGSKLERIGLD
LPFAVKMGSRLREQGIPLRAGYFTTEELVEELWTLYSKK
Download sequence
Identical sequences A0A063Z0X4 A0A0E0T821 A0A142D536 A0A1C3D7G7 A0A1V9BXR2 A0A2H5KHZ6 Q5L3R0 S7SYH1 T0NUV3 U2X4W2 V6VMH1
WP_011229647.1.100150 WP_011229647.1.19233 WP_011229647.1.2219 WP_011229647.1.22479 WP_011229647.1.25743 WP_011229647.1.45808 WP_011229647.1.50933 WP_011229647.1.60903 WP_011229647.1.6497 WP_011229647.1.70239 WP_011229647.1.80994 WP_011229647.1.90668 WP_011229647.1.91533 WP_011229647.1.93593 gi|56418670|ref|YP_145988.1| gi|319765294|ref|YP_004130795.1| gi|261417636|ref|YP_003251318.1| 235909.GK0135 544556.GYMC61_0136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]