SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011229800.1.3446 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011229800.1.3446
Domain Number 1 Region: 4-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.71e-50
Family ABC transporter ATPase domain-like 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011229800.1.3446
Sequence length 217
Comment MULTISPECIES: heme ABC exporter ATP-binding protein CcmA [Geobacillus]; AA=GCF_002042905.1; RF=na; TAX=1954237; STAX=1954237; NAME=Geobacillus sp. LEMMY01; strain=LEMMY01; AL=Contig; RT=Major
Sequence
MKAIVLSNVSKTIKAREVLRNINLELERGKIYGFVGPNGSGKTMLFRVISGLVKPSSGTV
AVFGQTLHQDVSFPSDISVLLEKPGFLEQYSGFDNLHFLAMIQNKIGEREVKEAIERVGL
NPHDKRPVKAYSLGMRQRLAIAQCIMEKPQLMLLDEPMNALDEKSVDQVYQIIREENKRG
CTILLTSHNKVDIQSLCHEVYSMNEGVITGMTHITAE
Download sequence
Identical sequences A0A063YVB0 A0A098L696 A0A0J0VA04 A0A1C3D4Y8 A0A1Q5SUM8 A0A1V4PAI2 A0A1V9BMK5 A0A223DXI9 A0A2H5KHK1 G8N357 Q5L3A4 U2YDS8
gi|375007173|ref|YP_004980805.1| WP_011229800.1.19233 WP_011229800.1.2219 WP_011229800.1.22479 WP_011229800.1.26402 WP_011229800.1.3446 WP_011229800.1.57889 WP_011229800.1.60903 WP_011229800.1.65208 WP_011229800.1.70239 WP_011229800.1.77642 WP_011229800.1.78869 WP_011229800.1.8599 WP_011229800.1.86012 WP_011229800.1.91533 WP_011229800.1.93593 235909.GK0291 gi|56418826|ref|YP_146144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]