SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011229812.1.2219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011229812.1.2219
Domain Number 1 Region: 354-591
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.06e-67
Family ABC transporter ATPase domain-like 0.000018
Further Details:      
 
Domain Number 2 Region: 26-319
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 1.7e-28
Family ABC transporter transmembrane region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011229812.1.2219
Sequence length 609
Comment lantibiotic ABC transporter ATP-binding protein [Geobacillus kaustophilus]; AA=GCF_000009785.1; RF=na; TAX=235909; STAX=1462; NAME=Geobacillus kaustophilus HTA426; strain=HTA426; AL=Complete Genome; RT=Major
Sequence
MNIKEYDDHVTIKDIVKSIRIVPKTLVLIKNVDKQSFFIIIFLSLLMGGAPIVTLLGSQN
LLNAIGSQNIHIIISALIFYISAVLLSEIISSFMEYYQNKFQTLINYKLNLQIMDKCTRL
SLQHFEDAEVYDMLQRVQNETPYKPFEVFLSILGAISAIVTFFSSMMILIHWKPWVLIIL
IFIPLVFSFYFFKIGQREFNVSWLRAPEKRKSWYLSYLMTRDNTFKEVKIYNLAGYILNK
FKEINKTFVEQDIHLFKRRTVFTFIFELVEQICINTVLVIIIISALAGEILIGHVVGLIQ
ALNLISSNSKKILNIIHSLYKNNLYINQLFEFLGLDEEVLDKGDRFVSGIDKIENIKIRN
LTFRYPTKPKVVLKNINLDINKGERIAIVGANGSGKSTLIKLLLKLYEHDEDSIFYNGVS
INDLDTEQLRKNIAVLFQDFVKYELKLTENVGFGDITRIDRDGELKQAMERARVNFIEDL
DTQLGLWFVDGVQLSGGQWQKVAIARALFRDASVYILDEPSSALDPISEKEVIDMFINMT
KDKIGIFISHRLSTAKLADKIVVMNDGEIVGIGTHWELLATNELYRRMYELEALKNEEEY
EHLNESAGL
Download sequence
Identical sequences Q5L392
gi|56418838|ref|YP_146156.1| 235909.GK0303 WP_011229812.1.2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]