SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011229854.1.26402 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011229854.1.26402
Domain Number 1 Region: 29-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-25
Family Nitrogenase iron protein-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011229854.1.26402
Sequence length 266
Comment MULTISPECIES: ATPase AAA [Geobacillus]; AA=GCF_002243605.1; RF=na; TAX=169283; STAX=169283; NAME=Geobacillus lituanicus; strain=N-3; AL=Complete Genome; RT=Major
Sequence
MYKTFYSLSREPFSKETNPPEAYQGASYQEALAALDYVKRTRGIGLLIGEPGAGKTFALR
AFKESLNPSLYHVVYFPLSTGSVMDFYRGLAFGLGEEPKYRKVDLFYQIQQGIERLYHEQ
RVTSVFILDEMHLAKDAFLQDIAILFNFHMDSTNPFVLILAGLPHLQAKLRLNQHRPLHQ
RIIMRYQMGPLDKEEVVGYIEHRLKQAGAKHPIFTPAALEAIALQSQGWPRIINNLATTC
LLYGAQLKKHMIDEDIVRMAAEEMGY
Download sequence
Identical sequences A0A063YX25 A0A087LB91 A0A098KY21 A0A142WC76 A0A1Q5SHL6 A0A1V4P6V4 A0A223DX62 A0A2H5KHE1 G8N3T4 L7ZUL0 Q5KZ98
235909.GK0350 235909.GK1703 gi|375007239|ref|YP_004980871.1| gi|375009463|ref|YP_004983096.1| WP_011229854.1.17728 WP_011229854.1.19233 WP_011229854.1.2219 WP_011229854.1.26402 WP_011229854.1.3446 WP_011229854.1.38513 WP_011229854.1.56669 WP_011229854.1.59290 WP_011229854.1.60903 WP_011229854.1.6497 WP_011229854.1.77642 WP_011229854.1.78869 WP_011229854.1.8599 WP_011229854.1.90668 WP_011229854.1.91533 gi|56418885|ref|YP_146203.1| gi|56420238|ref|YP_147556.1| gi|448237068|ref|YP_007401126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]