SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011230148.1.2219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011230148.1.2219
Domain Number 1 Region: 3-221
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.99e-59
Family ABC transporter ATPase domain-like 0.0000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011230148.1.2219
Sequence length 299
Comment MULTISPECIES: sodium ABC transporter ATP-binding protein [Geobacillus]; AA=GCF_000009785.1; RF=na; TAX=235909; STAX=1462; NAME=Geobacillus kaustophilus HTA426; strain=HTA426; AL=Complete Genome; RT=Major
Sequence
MSLEIIEVTKRFGQATAVDHLTLTVPEGEMFGLLGANGAGKTTTFRMILGLLLPTEGVIR
WQGEPIDYSKGHLIGYLPEERGLYPKLKVQEQLLYLGRLRGMKKTDILPEIDRWLERFHI
RDYANKRVEELSKGNQQKIQFIAAVLHRPKLLILDEPFSGLDPVNVELLKEAVLDLKRNG
TTIVFSSHRMEHVEELCEHVCILRRGRAVVAGALRELKRSFGKQILVIQGDGPFEELARF
PGVLQWKRTAEGVRLQIANEETAQAILGHIAGKVAVRLFALEEPSLNDIFIEKVGAAYE
Download sequence
Identical sequences A0A1V9BZE8 A0A2H5KGS0 Q5L2A1
235909.GK0644 gi|56419179|ref|YP_146497.1| WP_011230148.1.2219 WP_011230148.1.70239 WP_011230148.1.78869 WP_011230148.1.8599 WP_011230148.1.90668 WP_011230148.1.91533 WP_011230148.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]