SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011230225.1.2219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011230225.1.2219
Domain Number 1 Region: 3-204
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.9e-38
Family ABC transporter ATPase domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011230225.1.2219
Sequence length 216
Comment MULTISPECIES: ABC transporter ATP-binding protein [Geobacillus]; AA=GCF_000009785.1; RF=na; TAX=235909; STAX=1462; NAME=Geobacillus kaustophilus HTA426; strain=HTA426; AL=Complete Genome; RT=Major
Sequence
MEPLFSLQNLTYRYDGGATIFQQFSFSIFSGETVLLTGPNGVGKTTLLHIISGLLDKGEL
HYQAFYKGNPIQLPDMRAHLSYVTSETVMFSKLTGYENIECFRLLWKLDQQYVRKANELC
SLLGMEEMLPLPVDQYSLGTKQKLHIAIALARPVELYLMDEPFNSLDRLSRDRLAEWIQG
DRQHAYLIASHVHQERFPGSRIISLTRPNNEDKIEK
Download sequence
Identical sequences A0A0K1KD64 A0A164G340 A0A1C3D662 A0A1V9C940 A0A2H5KGK1 L7ZVT4 Q5L223
gi|56419257|ref|YP_146575.1| WP_011230225.1.17728 WP_011230225.1.20723 WP_011230225.1.2219 WP_011230225.1.22479 WP_011230225.1.38928 WP_011230225.1.56669 235909.GK0722 gi|448236902|ref|YP_007400960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]